PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10048467g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 308aa    MW: 34520.5 Da    PI: 6.7165
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10048467g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.9e-141764148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEd +l+ +++  G g+W+t ++  g+ R +k+c++rw ++l
  MA_10048467g0010 17 RGSWTPEEDRILKTYIEANGVGRWSTLPQNAGLMRRGKSCRLRWMNHL 64
                      89********************************************97 PP

2Myb_DNA-binding50.45.1e-1670113146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg  +++E+el+++++++lG++ W++Ia +++ gRt++++k++w++
  MA_10048467g0010  70 RGHISPDEEELIIRLHNLLGNR-WSLIAGRVP-GRTDNEVKNYWNT 113
                       67779*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.4071264IPR017930Myb domain
SuperFamilySSF466892.35E-2715111IPR009057Homeodomain-like
SMARTSM007177.5E-111666IPR001005SANT/Myb domain
PfamPF002496.0E-121764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-211871IPR009057Homeodomain-like
CDDcd001677.96E-101964No hitNo description
PROSITE profilePS5129425.1265119IPR017930Myb domain
SMARTSM007173.8E-1569117IPR001005SANT/Myb domain
PfamPF002491.3E-1470113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2472119IPR009057Homeodomain-like
CDDcd001673.64E-1274115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MKRTKGLSKP SDGALHRGSW TPEEDRILKT YIEANGVGRW STLPQNAGLM RRGKSCRLRW  60
MNHLRPNVKR GHISPDEEEL IIRLHNLLGN RWSLIAGRVP GRTDNEVKNY WNTRLSKKLG  120
TTSKNLAGSL ARRQIAKASP RIGVDNNAAV DLNSESANFK STPRLRSPTG STFLSDVQLS  180
SPECNNDNDR RTTTVVKDDI VHLAPLDVAH TNPGAVPPPE EIDQCTVQES GFVEQNDDMN  240
SLNKEQGPDS FLTPYNTCLD SLLWFNYFQE MDDLFHCDYA QETSFSVSVS DHLQYASFGS  300
QFGDDLIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23151215110B-MYB
1h8a_C2e-231511925128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A075LW644e-55A0A075LW64_MALDO; MYBPA1-like transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-51myb domain protein 5